PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG001896.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 333aa    MW: 36952.2 Da    PI: 5.2177
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG001896.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.9e-151966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l +++   G g+W+ +ar  g+ R++k+c++rw +yl
      CCG001896.1 19 KGLWSPEEDDKLMNYILNNGQGCWSDVARNAGLQRCGKSCRLRWINYL 66
                     678*******************************************97 PP

2Myb_DNA-binding44.73.1e-1472115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+e  ++++ +lG++ W+ Ia++++ gRt++++k++w++
      CCG001896.1  72 RGAFSPQEEEMTIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 115
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1981466IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-231569IPR009057Homeodomain-like
SuperFamilySSF466891.02E-2717113IPR009057Homeodomain-like
SMARTSM007177.6E-111868IPR001005SANT/Myb domain
PfamPF002495.7E-141966IPR001005SANT/Myb domain
CDDcd001673.52E-92266No hitNo description
PROSITE profilePS5129423.36867121IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2470122IPR009057Homeodomain-like
SMARTSM007173.3E-1371119IPR001005SANT/Myb domain
PfamPF002495.9E-1372115IPR001005SANT/Myb domain
CDDcd001674.35E-1074114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MRKPEASGKN NDISNKFKKG LWSPEEDDKL MNYILNNGQG CWSDVARNAG LQRCGKSCRL  60
RWINYLRPDL KRGAFSPQEE EMTIHLHSLL GNRWSQIAAR LPGRTDNEIK NFWNSTIKKR  120
LKSLQSSNAS PNTSDSSSEP SKEVMGGFMT MQEQGILPMN MDPSLSSSSS LETSMQAMIL  180
NTMMDPLLPM HDHDHGLNMY IGSASGYEFN GAPPCMTHQV GVNSSDHGLY GPEGIFGGVN  240
VGIPPLESVS CMEENAKSQT IQDDSTDKHP YSSYVISSLN KNCNTTSTDH NKTDNAAAEM  300
GNFWHGEELK VGEWDLEELM RDVSACPSLD FQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26191237110B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1486770.0KF148677.1 Populus trichocarpa MYB transcription factor (MYB2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011045438.10.0PREDICTED: transcription factor MYB46-like
SwissprotQ9LXV21e-72MYB46_ARATH; Transcription factor MYB46
TrEMBLS5YEC40.0S5YEC4_POPTR; MYB transcription factor
STRINGPOPTR_0001s26590.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.11e-71myb domain protein 46